ELISA Recombinant Bovine Lysosomal-associated transmembrane protein 5(LAPTM5)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q2KJA5 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAPRAAAIRQTCCCFNVRIATTALAIYHVIMSVLLFIEHSVEVAHGKASCKFSKTGYLRI AELVSSFLLITmLFIISLSLLVGVVKNREKYLLPFLSLQIMDFLLCLLTLMGSYIELPAY LKFASRSSRRVSPSKVPLMTLQLLDFCLSILTLCSSYMEVPTYLNFKSMNHMNYLPSQDG MTHNQFIKIMIIFSIAFITVLILKVYMFKCVWRCYRLMKCTNSAEERSGSKmLQKVVLPS YEEAVSLPYKVPEGGPAPPPYSEV Protein Names:Recommended name: Lysosomal-associated transmembrane protein 5 Alternative name(s): Lysosomal-associated mµLtitransmembrane protein 5 Gene Names:Name:LAPTM5 Expression Region:1-264 Sequence Info:fµLl length protein