ELISA Recombinant Bovine Transmembrane protein C14orf180 homolog
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:Q29RM6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKTAVHALSPDSRPETQHQTRKNEEAAPGSPTPRAGREGRKGPASILRRSPQERCGRGDE PRRTTRHVRFREPLEVAVHYIACREPTTAVQAPSRPRPRGGSLLLRLTACILLALALGMC CGQAGPMARALEDFRARLLAALLRLPLAALDCWRCLLQL
Protein Names:Recommended name: Transmembrane protein C14orf180 homolog
Gene Names:
Expression Region:1-159
Sequence Info:fµLl length protein
Our latest content
Check out what's new in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.