ELISA Recombinant Bovine Lipid phosphate phosphohydrolase 2(PPAP2C)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:Q2HJ61
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MERRWVFVLLDVLCVLVAALPCAILTFVNTPYKRGFYCGDDSIRYPYRPDTITHGLMAGV IITATVILVSAGEAYLVYTDRLYSRSDFNNYLAALYKVVGTFLFGAAVSQSLTDLAKYMT GRLRPNFLAVCDPDWSRVNCSAYVQVEVCRGSSANVTESRLSFYSGHSSFGMYCMVFLAL YVQARLCWKWARLLRPTVQFFLVAFALYVGYTRVSDHKHHWSDVLVGLLQGALVASLTVR YISDFFKARPPQHCPEEEDLERKPSLSLTLALGETDCNHYGYPVSSS
Protein Names:Recommended name: Lipid phosphate phosphohydrolase 2 EC= 3.1.3.4 Alternative name(s): PAP2-gamma Short name= PAP2-G Phosphatidate phosphohydrolase type 2c Phosphatidic acid phosphatase 2c Short name= PAP-2c Short n
Gene Names:Name:PPAP2C
Expression Region:1-287
Sequence Info:fµLl length protein
Our latest content
Check out what's new in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.