ELISA Recombinant Bovine Protein FAM18B1(FAM18B1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q29S14 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLQQDSNDDTEDVSLFDAEEETTNRPKKSRIRHPVASFFHLFFRVSAIIVYLLCELFSSS FIACMVTIILLLSCDFWAVKNVTGRLMVGLRWWNHIDEDGKSHWVFESRKASPQEGKTVS EAESRIFWLGLVACPVLWVVFAFSALFSFRVKWLAVVIMGVVLQGANLYGYIRCKVGSRK NLTSMATTYLGRQFLRQTTGDTQTSSGE Protein Names:Recommended name: Protein FAM18B1 Gene Names:Name:FAM18B1 Synonyms:FAM18B Expression Region:1-208 Sequence Info:fµLl length protein