ELISA Recombinant Bovine Protein lifeguard 2(FAIM2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q1LZ71 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTQGKLSVANKAPGTEGQQQANGEKKETPAVPSAPPSYEEATSGEGLKAGAFPPAPSAVP LHPSWAYVDPNSSSSYESGFPTGDHEFFTTFSWDDQKVRRVFIRKVYTILLIQLLVTLGV VALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSMA YLTGmLSSYYNTTSVLLCLSITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLI LAILLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLMGSRRHSLSPEEYIFGALNIYLDI IYIFTFFLQLFGTNRE Protein Names:Recommended name: Protein lifeguard 2 Alternative name(s): Fas apoptotic inhibitory molecµLe 2 Gene Names:Name:FAIM2 Synonyms:LFG2 Expression Region:1-316 Sequence Info:fµLl length protein