ELISA Recombinant Bovine 3-hydroxyacyl-CoA dehydratase 4(PTPLAD2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q0P5C7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGPVALPTWLQPRYRKNAYLFIYYLIQFCGHSWIFTNMTVRFFSFGKDSMVDTFYAIGLV MQLCQSISLLELLHIYVGIESNHLLPRILQLTERIIVLFMVITSQEEVQEKYVVCVLFIF RNLLDMVRYTYSmLSVIGISYAVLTWFSQTLWMPIYPLCVLAEAFTIYQSLPYFESFGTY STKLPFDLSFYFPYVLKIYLMmLFVGMYFTYNHLYSERRDILRVFPNKKKM Protein Names:Recommended name: 3-hydroxyacyl-CoA dehydratase 4 Short name= HACD4 EC= 4.2.1.- Alternative name(s): Protein tyrosine phosphatase-like protein PTPLAD2 Protein-tyrosine phosphatase-like A domain-containing protein 2 Gene Names:Name:PTPLAD2 Synonyms:HACD4 Expression Region:1-231 Sequence Info:fµLl length protein