ELISA Recombinant Bovine Bax inhibitor 1(TMBIM6)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q0V882 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNIFDRKINFDALFKFSHITPSTQQHLKKVYASFALCMFVAAAGAYIHVVTHFIQAGLLS ALGSLGLMIWLMATPHSHETEQKRLGLLAGFAFLTGVGLGPALDLCIAINPSILPTAFMG TAMIFTCFTLSALYARRRSYLFLGGILMSAMSLmLLSSLGNLFFGSVWLFQANLYMGLVV MCGFVLFDTQLIIEKAENGDKDYIWHCVDLFLDFVTLFRKLMMILAMNEKDKKKKK Protein Names:Recommended name: Bax inhibitor 1 Short name= BI-1 Alternative name(s): Testis-enhanced gene transcript protein Transmembrane BAX inhibitor motif-containing protein 6 Gene Names:Name:TMBIM6 Synonyms:TEGT Expression Region:1-236 Sequence Info:fµLl length protein