ELISA Recombinant Bovine Serine palmitoyltransferase small subunit B(SPTSSB)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q0IIK4 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDFKRVKDYLSWLYYQYQIISCCAVLEPWEQSMFNTIILTIFAMVVYTAYVFIPIHIRLA WEFFSKMCGYHSTISN Protein Names:Recommended name: Serine palmitoyltransferase small subunit B Alternative name(s): Protein ADMP Small subunit of serine palmitoyltransferase B Short name= ssSPTb Gene Names:Name:SPTSSB Synonyms:ADMP, SSSPTB Expression Region:1-76 Sequence Info:fµLl length protein