ELISA Recombinant Bovine Peroxisomal membrane protein 11A(PEX11A)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q0VCP2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDAFIRFTNQTQGRDRLFRATQYTCmLLRYLLEPKADNEKVVMKLKKLESSVSTGRKWFR LGNVVHALQATQQSVRATDLVPRICLTLASLNRVIYFICDTVLFVRSTGLASGVNKEKWR RWAARYYYYSLLLSLVRDLYEVSLQMKQVAHDRAKREKSPSQDTLGYSVADEETEWLQSL LLLLFHSLKRHPPLFLDTVKNFCDILNPLDQLGIYKSNPGIIGLGGLVSSVAGIITVAYP QMKLKTQ Protein Names:Recommended name: Peroxisomal membrane protein 11A Alternative name(s): Peroxin-11A Peroxisomal biogenesis factor 11A Gene Names:Name:PEX11A Expression Region:1-247 Sequence Info:fµLl length protein