ELISA Recombinant Bovine Fat storage-inducing transmembrane protein 1(FITM1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:A7YWN2 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MERGPVVGAGRGAGARIRALLGGLVRVLLWVASALLYFGSEQAARLLGSPCLRRLYHAWL AAVVIFGPLLQFHVNPRTIFASHGNFFNIKFVNSAWGWTCTFLGGFVLLVVFLATRRVAV TARHLSRLVVGAAVWRGAGRAFLLIEDLTGSCFEPLPQGLLLHELPDRRSCLAAGHQWRG YTVSSHTFLLTFCCLLMAEEAAVFAKYLAHGLPAGAPLRLVFLLNVLLLGLWNFLLLCTV IYFHQYTHKVVGAAVGTFAWYLTYGSWYHQPWSPGSPGHGLFPRPHSIHKHN Protein Names:Recommended name: Fat storage-inducing transmembrane protein 1 Alternative name(s): Fat-inducing protein 1 Gene Names:Name:FITM1 Synonyms:FIT1 Expression Region:1-292 Sequence Info:fµLl length protein