ELISA Recombinant Canine coronavirus Non-structural protein 7a (7a)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Canine coronavirus (strain Insavc-1) (CCoV) (Canine enteric coronavirus)
Uniprot NO.:P36301
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LERLLLNHSLNLKTVNNVLGVTHTGLKVNCLQLLKPDCLDFNILHRSLAETRLLKVVLRV IFLVLLGFCCYRLLVTLF
Protein Names:Recommended name: Non-structural protein 7a Short name= ns7a Alternative name(s): 11 kDa protein Accessory protein 7a X3 protein
Gene Names:ORF Names:7a
Expression Region:24-101
Sequence Info:fµLl length protein
Our latest content
Check out what's new in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.