Skip to Content

ELISA Recombinant Bovine respiratory syncytial virus Major surface glycoprotein G(G)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bovine respiratory syncytial virus (strain Copenhagen) (BRS) Uniprot NO.:P22261 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSNHTHHLKFKTLKRAWKASKYFIVGLSCLYKFNLKSLVQTALSTLAMITLTSLVITAII YISVGNAKAKPTSKPTIQQTQQPQNHTSPFFTEHNYKSTHTSIQSTTLSQLLNIDTTRGI TYGHSTNETQNRKIKGQSTLPATRKPPINPSGSIPPENHQDHNNFQTLPYVPCSTCEGNL ACLSLCHIETERAPSRAPTITLKKTPKPKTTKKPTKTTIHHRTSPETKLQPKNNTATPQQ GILSSTEHHTNQSTTQI Protein Names:Recommended name: Major surface glycoprotein G Alternative name(s): Attachment glycoprotein G Membrane-bound glycoprotein Short name= mG Gene Names:Name:G Expression Region:1-257 Sequence Info:fµLl length protein
1.00 € 1.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.