Skip to Content

ELISA Recombinant Brucella abortus biovar 1 Aquaporin Z(aqpZ)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Brucella abortus biovar 1 (strain 9-941) Uniprot NO.:P0C112 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLNKLSAEFFGTFWLVFGGCGSAILAAAFPELGIGFLGVALAFGLTVLTMAYAVGGISGG HFNPAVSLGLTVAGRLPAKDLIPYWVAQVLGAIAAAAILYVIASGKDGFSAGGLASNGYG ELSPGGYSMMAGLLIEIILTAFFIIIILGSTSSLAPAGFAPIAIGFGLTLIHLVSIPVTN TSVNPARSTGVALFADRAALSQLWLFWVAPLVGAVIGAIIWKGLLGRD Protein Names:Recommended name: Aquaporin Z Alternative name(s): Aquaporin X Gene Names:Name:aqpZ Synonyms:aqpX Ordered Locus Names:BruAb1_1976 Expression Region:1-228 Sequence Info:fµLl length protein
1.00 € 1.00 €

This combination does not exist.

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.