Skip to Content

ELISA Recombinant Bovine viral diarrhea virus Genome polyprotein

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bovine viral diarrhea virus (strain SD-1) (BVDV) (Mucosal disease virus) Uniprot NO.:Q01499 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SSWFLQASSKQMSLTPLFEELLLRCPPATKSNKGHMASAYQLAQGNWEPLGCGVHLGTVP ARRVKMHPYEAYLKLKDLVEEEEKKPRIRDTVIREHNKWILKKIKFQGNLNTKKmLNPGK LSEQLDREGHKRNIYNNQISTVMSSAGIRLEKLPIVRAQTDTKSFHEAIRDKIDKNENRQ NPELHNKLLEIFHTIADPSLKHTYGEVTWEQLEAGINRKGAAGFLEKKNIGEVLDSEKHL VEQLVRDLKAGRKIRYYETAIPKNEKRDVSDDWQAGDLVDEKKPRVIQYPEAKTRLAITK VMYNWVKQQPVVIPGYEGKTPLFNIFNKVRKEWDLFNEPVAVSFDTKAWDTQVTSRDLHL IGEIQKYYYRKEWHKFIDTITDHMVEVPVITADGEVYIRNGQRGSGQPDTSAGNSmLNVL TMIYAFCESTGVPYKSFNRVAKIHVCGDDGFLITEKGLGLKFSNKGMQILHEAGKPQKLT EGEKMKVAYKFEDIEFCSHTPVPVRWSDNTSSYMAGRDTAVILSKMATRLDSSGERGTTA YEKAVAFSFLLMYSWNPLVRRICLLVLSQRPETAPSTQTTYYYKGDPIGAYKDVIGRNLS ELKRTGFEKLANLNLSLSTLGIWTKHTSKRIIQDCVAIGKEEGNWLVNADRLISSKTGHL YIPDKGFTLQGKHYEQLQLGAETNPVMGVGTERYKLGPIVNLLLRRLKVLLMAAVGASS Protein Names:Recommended name: Genome polyprotein Cleaved into the following 13 chains: 1. N-terminal protease Short name= 2. N-pro EC= 3. 3.4.22.- Alternative name(s): Autoprotease p20 Capsid protein C E(rns) glycoprotein Alternative Gene Names: Expression Region:3180-3898 Sequence Info:fµLl length protein
1.00 € 1.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.