ELISA Recombinant Bovine Uroplakin-1a(UPK1A)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:P38572 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MASAAAATTEKGSPVVVGLLVMGNIIILLSGLALFAETVWVTADQYRIYPLMGVSGKDDV FAGAWIAIFCGFSFFVVASFGVGAALCRRRSMILTYLILmLIIYIFECASCITSYTHRDY MVSNPSLITKQmLTFYSADSNQGRELTRLWDRIMIEQECCGTSGPMDWVNFTSAFRATTP EVVFPWPPLCCRRTGNFIPVNEEGCRLGHLDYLFTKGCFEHIGHAIDSYTWGISWFGFAI LMWTLPVmLIAMYFYTTL Protein Names:Recommended name: Uroplakin-1a Short name= UP1a Alternative name(s): Uroplakin Ia Short name= UPIa Gene Names:Name:UPK1A Expression Region:1-258 Sequence Info:FµLl length protein