ELISA Recombinant Bovine Translocator protein(TSPO)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:P30535 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAPPWVPAVGFTLLPSLGGFLGAQYTRGEGFRWYASLQKPPWHPPRWILAPIWGTLYSAM GYGSYMIWKELGGFSKEAVVPLGLYAGQLALNWAWPPLFFGTRQMGWALVDLLLTGGMAA ATAMAWHQVSPPAACLLYPYLAWLAFAGmLNYRMWQDNQVRRSGRRLSE Protein Names:Recommended name: Translocator protein Alternative name(s): Isoquinoline-binding protein Short name= IBP PKBS Peripheral-type benzodiazepine receptor Short name= PBR Gene Names:Name:TSPO Synonyms:BZRP Expression Region:1-169 Sequence Info:FµLl length protein