ELISA Recombinant Bovine Synapse differentiation-inducing gene protein 1-like(SYNDIG1L)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:A4IFJ1 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MESLSELQNPLLPRSPTHLHGPYPYPEASPAWPCREKIYSYLLGGAGPAHAHQLLDPGSL QLAVEAWYRPSCLLGRDKVKEPRPGSCETSFTEGREPPAGPTERSTEPGQAEEDVAIQTV SYGVQEEFQGQEGDPEEEESDATSTESESEDNFLTLPPRDHLGLTIFSmLCCFWPLGIAA FYFSQGTSKAISKGDFRLANTTSRRALFLATLSIAVGAGLYVAVVVALAAYMSQNGHS Protein Names:Recommended name: Synapse differentiation-inducing gene protein 1-like Alternative name(s): Capucin Transmembrane protein 90A Gene Names:Name:SYNDIG1L Synonyms:TMEM90A Expression Region:1-238 Sequence Info:FµLl length protein