Skip to Content

ELISA Recombinant Bovine Zinc transporter 7(SLC30A7)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:A4IFD7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLPLSIKDDEYKPPKFNLFRKISGWFRSILSDKTSRNLFFFLCLNLSFAFVELLYGIWSN CLGLISDSFHMFFDSTAILAGLAASVISKWRDNDAFSYGYVRAEVLAGFVNGLFLIFTAF FIFSEGVERALAPPDVHHERLLLVSILGFVVNLVGIFVFKHGGHGHSHGSGHGHSHSLFN GALDQTHGHGDHCHSHELKHGAAHSHDHAHGHGHFHSHDGPSLKETTGPSRQILQGVFLH ILADTLGSIGVIASAIMMQNFGLMIADPICSILIAmLIVISVIPLLRESVGILMQRTPPL LENTLPQCYQRVQQLQGVYSLQEQHFWTLCSDVYVGTLKLVVAPDADARWILSQTHNIFT QAGVRQLYVQIDFAAM Protein Names:Recommended name: Zinc transporter 7 Short name= ZnT-7 Alternative name(s): Solute carrier family 30 member 7 Gene Names:Name:SLC30A7 Synonyms:ZNT7 Expression Region:1-376 Sequence Info:FµLl length protein
1.00 € 1.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.