Skip to Content

ELISA Recombinant Bovine ADP-ATP translocase 1(SLC25A4)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:P02722 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SDQALSFLKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRI PKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGG AAGATSLCFVYPLDFARTRLAADVGKGAAQREFTGLGNCITKIFKSDGLRGLYQGFNVSV QGIIIYRAAYFGVYDTAKGmLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQ SGRKGADIMYTGTVDCWRKIAKDEGPKAFFKGAWSNVLRGMGGAFVLVLYDEIKKFV Protein Names:Recommended name: ADP/ATP translocase 1 Alternative name(s): ADP,ATP carrier protein 1 ADP,ATP carrier protein, heart isoform T1 Adenine nucleotide translocator 1 Short name= ANT 1 Solute carrier family 25 member 4 Gene Names:Name:SLC25A4 Synonyms:ANT1 Expression Region:2-298 Sequence Info:FµLl length protein
1.00 € 1.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.