ELISA Recombinant Bovine S-adenosylmethionine mitochondrial carrier protein(SLC25A26)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:A6QR09 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MDRPGFTASLVAGGVAGVSVDLILFPLDTIKTRLQSPQGFYKAGGFYGVYAGVPSTAIGS FPNAAAFFVTYEYVKWILHTDSSSYLMPVTHmLAASVGEVVACLIRVPSEVVKQRAQVSA SSGTFHIFSNILCQEGIQGLYRGYKSTVLREIPFSLVQFPLWESLKALWSWRQDRVVDSW QAAVCGAFAGGFAAAVTTPLDVAKTRImLAKAGSSTASGNILSALHAVWRTQGLSGLFAG VFPRMAAISLGGFIFLGVYDQTRSFLLELGRESP Protein Names:Recommended name: S-adenosylmethionine mitochondrial carrier protein Alternative name(s): Mitochondrial S-adenosylmethionine transporter Solute carrier family 25 member 26 Gene Names:Name:SLC25A26 Synonyms:SAMC Expression Region:1-274 Sequence Info:FµLl length protein