ELISA Recombinant Bovine Succinate dehydrogenase cytochrome b560 subunit, mitochondrial(SDHC)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:P35720 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:LGTTAKEEMERFWSKNTTLNRPLSPHISIYGWSLPMAMSICHRGTGIALSAGVSLFGLSA LLVPGSFESHLEFVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLTISQLH QSGVAVLVLTVLSSVGLAAM Protein Names:Recommended name: Succinate dehydrogenase cytochrome b560 subunit, mitochondrial Alternative name(s): Integral membrane protein CII-3 QPs-1 Short name= QPs1 Succinate dehydrogenase complex subunit C Gene Names:Name:SDHC Synonyms:CYB560 Expression Region:30-169 Sequence Info:FµLl length protein