ELISA Recombinant Bovine Succinate dehydrogenase cytochrome b560 subunit, mitochondrial(SDHC)
Quantity:50 µg. Other Quantitys are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:P35720
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:LGTTAKEEMERFWSKNTTLNRPLSPHISIYGWSLPMAMSICHRGTGIALSAGVSLFGLSA LLVPGSFESHLEFVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLTISQLH QSGVAVLVLTVLSSVGLAAM
Protein Names:Recommended name: Succinate dehydrogenase cytochrome b560 subunit, mitochondrial Alternative name(s): Integral membrane protein CII-3 QPs-1 Short name= QPs1 Succinate dehydrogenase complex subunit C
Gene Names:Name:SDHC Synonyms:CYB560
Expression Region:30-169
Sequence Info:FµLl length protein
Our latest content
Check out what's new in our company !
Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.