Skip to Content

ELISA Recombinant Bovine Phosphatidylinositide phosphatase SAC1(SACM1L)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:A6QL88 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAATTYERLKLHVTPEKFYVEACDDGADDVLIIDRVSTEVTLSVKKDIPPSAVTRPIFGI LGTIHLVAGNYLIVITKKKKIGEFFNHVIWKATDFDVLSYKKTmLHLTDIQLQDNKTFLA MMNHVLSMDGFYFSTTYDLTHTLQRLSNTSPEFQEMSLLERADQRFVWNGHLLRELSAQP EVHRFALPVLHGFITMHSCSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVET EQIVHYNGSRASFVQTRGSIPLYWSQRPNLKYKPLPLINKVANHMDGFQRHFDSQIIIYG KQVIINLVNQKGSEKPLEQAFATMVSSLGNGMIRYIAFDFHKECKNMRWDRLSILLDQVA EMQDELSYFLVDPAGVVLSTQEGVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHV GQKLEEQDEFEKIYKNAWADNANACAKQYAGTGALKTDFTRTGKRTQLGLIMDGWNSLIR YYKNNFSDGFRQDSIDLFLGNYSVDELESHSPLSVPRDLKFLALPIIMVVAFSMCIICLL MAGDTWTETLAYVLFWGVASIGTFFIILYNGKDFVDAPRLVQKEKID Protein Names:Recommended name: Phosphatidylinositide phosphatase SAC1 EC= 3.1.3.- Alternative name(s): Suppressor of actin mutations 1-like protein Gene Names:Name:SACM1L Expression Region:1-587 Sequence Info:FµLl length protein
1.00 € 1.00 €

Not Available For Sale

This combination does not exist.

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.