ELISA Recombinant Bovine Prostaglandin E synthase(PTGES)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q95L14 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MPPSGLELMNGQVLPAFLLCSALLVIKMYVVAVITGQVRLRKKAFANPEDAQRHGGLQYC RNDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVARMHFLVFFLGRMVHTVAYLG KLRAPTRSLAYTLAQLPCASMALQIVWEAARHL Protein Names:Recommended name: Prostaglandin E synthase EC= 5.3.99.3 Alternative name(s): Microsomal prostaglandin E synthase 1 Short name= MPGES-1 Gene Names:Name:PTGES Expression Region:1-153 Sequence Info:fµLl length protein