ELISA Recombinant Bovine Prostaglandin D2 receptor(PTGDR)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:A5D7K8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MRPLFYRCHNTTSVEKGNSATMGGVLFSTGLVGNLLALGLLARSGLGSCPPRSPRPPPSV FYVLVFGLTITDLLGKCLVSPFVLSAYAQNRSLRELVPGSDSSLCQAFAFIMSFFGLAST LQLLAMALECWLSLGHPFFHRRHLTPRRGAMVAPVVGAFCLAFCALPLVGFGKFVQYCPG TWCFFQMVHEERSLSVLSYSVLYASLmLLLVLAIVLCNLSAMRNLYAMHLRLRGLLRPGS RERAEPGAGEREATPLHLEELDHLLLLALMTVLFTMCSLPLIYRAYYGAFKAVPEQNGTT EETEDLRALRFLSVISIVDPWIFIIFRTSVFRMFFRKIFIRPLIYRNWHSNSCQTNMESS L Protein Names:Recommended name: Prostaglandin D2 receptor Short name= PGD receptor Short name= PGD2 receptor Alternative name(s): Prostanoid DP receptor Gene Names:Name:PTGDR Expression Region:1-361 Sequence Info:FµLl length protein