ELISA Recombinant Bovine Phosphatidylethanolamine N-methyltransferase(PEMT)
Quantity:50 µg. Other Quantitys are also available.
Product Type:Recombinant Protein
Species:Bos taurus (Bovine)
Uniprot NO.:Q7YRH6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:TRLLGYVDLSEPHFVAAVLAIVFNPLFWNVVARWEHKTRKLSKAFGSPRLACYTLGGAIL LLNVLRSHCFTQAmLSQPRMQSLDNPAVYHVGLALLGVGGVFVLSSFLALGFTGTFLGDY FGILKEARVTMFPFSVLDNPMYWGSTAIYLGWAIVHASPTGLLLTALVALIYMVAIVYEE PFTAEIYQQKASQAYKRS
Protein Names:Recommended name: Phosphatidylethanolamine N-methyltransferase Short name= PEAMT Short name= PEMT EC= 2.1.1.17 Alternative name(s): PEMT2
Gene Names:Name:PEMT Synonyms:PEMT2
Expression Region:2-199
Sequence Info:fµLl length protein
                            
                            
                            Our latest content
Check out what's new in our company !
                                Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.