ELISA Recombinant Bovine Oxidized low-density lipoprotein receptor 1(OLR1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:P79391 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MTVDDPKGMKDQLDQKPNGKTAKGFVSSWRWYPAAVTLGVLCLGLLVTVILLILQLSQVSDLIKKQQANITHQEDILEGQILAQRRSEKSAQESQKELKEMIETLAHKLDEKSKKLMELHRQNLNLQEVLKEAANYSGPCPQDWLWHEENCYQFSSGSFNWEKSQENCLSLDAHLLKINSTDELEFIQQMIAHSSFPFWMGLSMRKPNYSWLWEDGTPLTPHLFRIQGAVSRMYPSGTCAYIQRGTVFAENCILTAFSICQKKANLLRAQ Protein Names:Recommended name: Oxidized low-density lipoprotein receptor 1 Short name= Ox-LDL receptor 1 Alternative name(s): Lectin-like oxidized LDL receptor 1 Short name= LOX-1 Short name= Lectin-like oxLDL receptor 1 Short name= bLOX-1 Lectin-type oxidized LDL receptor 1 Cleaved into the following 2 chains: 1. Oxidized low-density lipoprotein receptor 1, soluble form A 2. Oxidized low-density lipoprotein receptor 1, soluble form B Gene Names:Name:OLR1 Synonyms:LOX1 Expression Region:1-270 Sequence Info:fµLl length protein