ELISA Recombinant Bovine Sodium-potassium-transporting ATPase subunit beta-1-interacting protein 2(NKAIN2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:A6QNL6 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGYCSGRCTLIFICGMQLVCVLERQIFDFLGYQWAPILANFVHIIIVILGLFGTIQYRPR YITGYAVWLVLWVTWNVFVICFYLEAGDLSKETDLILTFNISMHRSWWMENGPGCTVTSV TPAPDWAPEDHRYITVSGCFLEYQYIEVAHSSLQIVLALAGFIYACYVVKCITEEEDSFD FIGGFDSYGYQGPQKTSHLQLQPMYMQIPLDNN Protein Names:Recommended name: Sodium/potassium-transporting ATPase subunit beta-1-interacting protein 2 Short name= Na(+)/K(+)-transporting ATPase subunit beta-1-interacting protein 2 Gene Names:Name:NKAIN2 Expression Region:1-213 Sequence Info:FµLl length protein