ELISA Recombinant Bovine NADH dehydrogenase [ubiquinone] 1 subunit C2(NDUFC2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q02827 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MMTGRQGRATFQFLPDEARSLPPPKLTDPRLAFVGFLGYCSGLIDNAIRRRPVLLAGLHR QLLYITSFVFVGYYLLKRQDYMYAVRDHDMFSYIKSHPEDFPEKDKKTYGEVFEEFHPVR Protein Names:Recommended name: NADH dehydrogenase [ubiquinone] 1 subunit C2 Alternative name(s): Complex I-B14.5b Short name= CI-B14.5b NADH-ubiquinone oxidoreductase subunit B14.5b Gene Names:Name:NDUFC2 Expression Region:1-120 Sequence Info:FµLl length protein