ELISA Recombinant Brucella abortus ATP synthase subunit a(atpB)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Brucella abortus (strain S19) Uniprot NO.:B2S9M8 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MANDPIHQFQVSRWIPIDVGGVDLSFTNVSAFMVATVVLASGFLYLTSSGRGLIPTRLQS VSEMAYEFVATSLRDSAGSKGMKFFPFVFSLFMFVLVANFIGLFPYFYTVTSQIIVTFAL SLLVIGTVIFYGFFKHGFGFLKLFVPSGVPGIIVPLVVLIEIISFLSRPISLSVRLFANM LAGHITLKVFAGFVVSLSSLGALGIGGAVLPLLMTVAITALEFLVAFLQAYVFTVLTCMY INDAVHPGH Protein Names:Recommended name: ATP synthase subunit a Alternative name(s): ATP synthase F0 sector subunit a F-ATPase subunit 6 Gene Names:Name:atpB Ordered Locus Names:BAbS19_I03800 Expression Region:1-249 Sequence Info:fµLl length protein