ELISA Recombinant Bovine Leukocyte cell-derived chemotaxin 1(LECT1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:P17404 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ELVRKIVTTTTTRRLRSGPQGTPAPGRPNNGTRPSVQEDAEPFNPDNPYHQQEGESMTFD PRLDHEGICCIECRRSYTHCQKICEPLGGYHPWPYNYQGCRSACRVIMPCSWWVARILGM V Protein Names:Recommended name: Leukocyte cell-derived chemotaxin 1 Alternative name(s): Small cartilage-derived glycoprotein Short name= SCGP Cleaved into the following 2 chains: 1. Chondrosurfactant protein Short name= 2. CH-SP 3. Chondr Gene Names:Name:LECT1 Synonyms:CHMI Expression Region:215-335 Sequence Info:FµLl length protein