ELISA Recombinant Bovine ER lumen protein retaining receptor 1(KDELR1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:P33946 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MNLFRFLGDLSHLLAIILLLLKIWKSRSCAGISGKSQVLFAVVFTARYLDLFTNYISLYN TCMKVVYIACSFTTVWMIYSKFKATYDGNHDTFRVEFLVIPTAILAFLVNHDFTPLEILW TFSIYLESVAILPQLFMVSKTGEAETITSHYLFALGVYRTLYLFNWIWRYHFEGFFDLIA IVAGLVQTVLYCDFFYLYITKVLKGKKLSLPA Protein Names:Recommended name: ER lumen protein retaining receptor 1 Alternative name(s): KDEL endoplasmic reticµLum protein retention receptor 1 Short name= KDEL receptor 1 Gene Names:Name:KDELR1 Synonyms:KDELR Expression Region:1-212 Sequence Info:FµLl length protein