ELISA Recombinant Bovine Ovarian cancer G-protein coupled receptor 1(GPR68)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:O46685 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MGNITADNTSMNCDIDHTIHQTLAPVVYVMVLVVGFPANCLSLYYGYLQIKARNELGVYL CNLTVADLFYICSLPFWLQYVLQHDHWSHDDLSCQVCGILLYENIYISVGFLCCISIDRY LAVAHPFRFHQFRTLKAAMGVSALIWVKELLTSIYFLMHEEVVEDADRHRVCFEHYPLEP RQRGINYYRFLVGFLFPICLLLASYRGILRAVRRSHGTQKSRKDQIQRLVLSTVVIFLAC FLPYHVLLLVRSLWESSCDFAKGIFNAYHFSLLLTSFNCVADPVLYCFVSETTHRDLARL RGACLAFLTCARTGRAREAYPLGAPEASGKSEDPEVLTRLHPAFQTPHPPGMGGSPAGGL S Protein Names:Recommended name: Ovarian cancer G-protein coupled receptor 1 Alternative name(s): G protein-coupled receptor RGR1 Short name= bRGR1 G-protein coupled receptor 68 Gene Names:Name:GPR68 Expression Region:1-361 Sequence Info:FµLl length protein