Skip to Content

ELISA Recombinant Bovine Short-chain dehydrogenase-reductase 3(DHRS3)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:O77769 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVWKRLGALVVFPLQMIYLVVKAAVGLVLPAKLRDLSRENVLITGGGRGIGRQLAREFAE RGARKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNREEVYQTAKAVREKVGDITIL VNNAAVVHGKSLMDSDDDALPKSQHINTLGQFWTTKAFLPRmLELQNGHIVCLNSVLALS AIPGAIDYCTSKASAFAFMESLTLGLLDCPGVSATTVLPFHTSTEMFQGMRVRFPNLFPP LKPETVARRTVEAVQLNQALLLLPWTMHALIILKSILPQAALEEIHKFSGTYTCINTFKG RT Protein Names:Recommended name: Short-chain dehydrogenase/reductase 3 EC= 1.1.1.300 Alternative name(s): Retinal short-chain dehydrogenase/reductase 1 Short name= retSDR1 Gene Names:Name:DHRS3 Expression Region:1-302 Sequence Info:FµLl length protein
1.00 € 1.00 €

This combination does not exist.

Our latest content

Check out what's new in our company !

Your Dynamic Snippet will be displayed here... This message is displayed because you did not provide both a filter and a template to use.