ELISA Recombinant Bovine Cytochrome c1, heme protein, mitochondrial(CYC1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:P00125 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:SDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCSSCHSMDYVAYRHLVGVCYTEDE AKALAEEVEVQDGPNEDGEMFMRPGKLSDYFPKPYPNPEAARAANNGALPPDLSYIVRAR HGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIGMAPPIYNEVLEFDDGTPATMS QVAKDVCTFLRWAAEPEHDHRKRMGLKmLLMMGLLLPLVYAMKRHKWSVLKSRKLAYRPP K Protein Names:Recommended name: Cytochrome c1, heme protein, mitochondrial Alternative name(s): Complex III subunit 4 Complex III subunit IV Cytochrome b-c1 complex subunit 4 Ubiquinol-cytochrome-c reductase complex cytochrome c1 subunit Short n Gene Names:Name:CYC1 Expression Region:85-325 Sequence Info:FµLl length protein