ELISA Recombinant Bovine Cytochrome b561(CYB561)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:P10897 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MEGPASPARAPGALPYYVAFSQLLGLIVVAMTGAWLGMYRGGIAWESALQFNVHPLCMII GLVFLQGDALLVYRVFRNEAKRTTKVLHGLLHVFAFVIALVGLVAVFEHHRKKGYADLYS LHSWCGILVFALFFAQWLVGFSFFLFPGASFSLRSRYRPQHVFFGAAIFLLSVATALLGL KEALLFELGTKYSMFEPEGVLANVLGLLLATFATVILYILTRADWKRPLQAEEQALSMDF KTLTEGDSPSSQ Protein Names:Recommended name: Cytochrome b561 Alternative name(s): Cytochrome b-561 Gene Names:Name:CYB561 Expression Region:1-252 Sequence Info:FµLl length protein