ELISA Recombinant Bovine Cytochrome c oxidase subunit 4 isoform 1, mitochondrial(COX4I1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:P00423 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQKALKEKEKASWSSLSIDEKVELY RLKFKESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIWEKHYVYGPIPHTFEEEWVAKQT KRmLDMKVAPIQGFSAKWDYDKNEWKK Protein Names:Recommended name: Cytochrome c oxidase subunit 4 isoform 1, mitochondrial Alternative name(s): Cytochrome c oxidase polypeptide IV Cytochrome c oxidase subunit IV isoform 1 Short name= COX IV-1 Gene Names:Name:COX4I1 Synonyms:COX4 Expression Region:23-169 Sequence Info:FµLl length protein