ELISA Recombinant Bovine B-cell antigen receptor complex-associated protein alpha chain(CD79A)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:P40293 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:LWVEWGPPSVTVSVGEEVRLQCTHNGSNTNVTWWHVLQSNSSWPPVMYRGDVGAGGELIIKPVNKTHRGMYRCQVSDGKKIQRSCGTYLRVRDPLPRPFLDMGEGTKNNIITAEGIILLICAVVPGTLLLFRKRWQNMKFGADIQDDYEDENLYEGLNLDDCSMYEDISRGLQGTYQDVGSLHIGDAQLEKP Protein Names:Recommended name: B-cell antigen receptor complex-associated protein alpha chain Alternative name(s): Ig-alpha MB-1 membrane glycoprotein Membrane-bound immunoglobµLin-associated protein Surface IgM-associated protein CD_antigen= CD79a Gene Names:Name:CD79A Synonyms:IGA, MB-1 Expression Region:32-223 Sequence Info:fµLl length protein