ELISA Recombinant Bovine C-C chemokine receptor type 11(CCRL1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:P35350 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MAVEYNQSTDYYYEENEMNDTHDYSQYEVICIKEEVRKFAKVFLPAFFTIAFIIGLAGNS TVVAIYAYYKKRRTKTDVYILNLAVADLFLLFTLPFWAVNAVHGWVLGKIMCKVTSALYT VNFVSGMQFLACISTDRYWAVTKAPSQSGVGKPCWVICFCVWVAAILLSIPQLVFYTVNH KARCVPIFPYHLGTSMKASIQILEICIGFIIPFLIMAVCYFITAKTLIKMPNIKKSQPLK VLFTVVIVFIVTQLPYNIVKFCQAIDIIYSLITDCDMSKRMDVAIQITESIALFHSCLNP VLYVFMGTSFKNYIMKVAKKYGSWRRQRQNVEEIPFESEDATEPTSTFSI Protein Names:Recommended name: C-C chemokine receptor type 11 Short name= C-C CKR-11 Short name= CC-CKR-11 Short name= CCR-11 Alternative name(s): CC chemokine receptor-like 1 Protein PPR1 Putative gustatory receptor type B Gene Names:Name:CCRL1 Synonyms:CCR11 Expression Region:1-350 Sequence Info:FµLl length protein