ELISA Recombinant Bovine Aquaporin-4(AQP4)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:O77750 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSDRPAARRWGKCGPLCTRESIMVAFKGVWTQTFWKAVTAEFLAmLIFVLLSLGSTINWG GAEKPLPVDMVLISLCFGLSIATMVQCFGHISGGHINPAVTVAMVCTRRISIAKSVFYIA AQCLGAIIGAGILYLVTPPSVVGGLGVTTVHGNLSAGHGLLVELIITFQLVFTIFASCDS KRTDVTGSIALAIGISVAIGHLFAINYTGASMNPARSFGPAVIMGNWENHWIYWVGPIIG AVLAGGLYEYVFCPDVELKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVH VIDIDRGEEKKGKDPSGEVLSSV Protein Names:Recommended name: Aquaporin-4 Short name= AQP-4 Alternative name(s): Mercurial-insensitive water channel Short name= MIWC WCH4 Gene Names:Name:AQP4 Expression Region:1-323 Sequence Info:FµLl length protein