ELISA Recombinant Bovine Odorant-binding protein

Quantity: 20µg. Other Quantitys are also available. Please Inquire. In Stock: No Lead time: 25-35 working days Research Topic: Others Uniprot ID: P07435 Gene Names: N/A Organism: Bos taurus (Bovine) AA Sequence: ENLYFQGAQEEEAEQNLSELSGPWRTVYIGSTNPEKIQENGPFRTYFRELVFDDEKGTVDFYFSVKRDGKWKNVHVKATKQDDGTYVADYEGQNVFKIVSLSRTHLVAHNINVDKHGQTTELTELFVKLNVEDEDLEKFWKLTEDKGIDKKNVVNFLENEDHPHPE Expression Region: 1-159aa Sequence Info: FµLl Length Source: BacµLovirus Tag Info: N-terminal 10xHis-tagged MW: 21.9 kDa Alternative Name(s): Olfactory mucosa pyrazine-binding protein Relevance: This protein binds a wide variety of chemical odorants. Reference: "Three-dimensional structure and active site of three hydrophobic molecµLe-binding proteins with significant amino acid sequence similarity." Monaco H.L., Zanotti G. Biopolymers 32:457-465(1992) Purity: Greater than 85% as determined by SDS-PAGE. Storage Buffer: Tris-based buffer，50% glycerol Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.